Lineage for d4lo1a1 (4lo1 A:9-151)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792306Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2792307Protein automated matches [226913] (9 species)
    not a true protein
  7. 2792330Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)
  8. 2792339Domain d4lo1a1: 4lo1 A:9-151 [253660]
    Other proteins in same PDB: d4lo1a3, d4lo1b3
    automated match to d2e4ma1
    complexed with gal

Details for d4lo1a1

PDB Entry: 4lo1 (more details), 2.25 Å

PDB Description: ha17-ha33-gal
PDB Compounds: (A:) ha-33

SCOPe Domain Sequences for d4lo1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lo1a1 b.42.2.0 (A:9-151) automated matches {Clostridium botulinum [TaxId: 1491]}
nslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihn
tnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
lstlnnsnyikfiiedyiisdln

SCOPe Domain Coordinates for d4lo1a1:

Click to download the PDB-style file with coordinates for d4lo1a1.
(The format of our PDB-style files is described here.)

Timeline for d4lo1a1: