Lineage for d4lnnl1 (4lnn L:2-104)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639568Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 1639693Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 1639694Protein automated matches [226862] (3 species)
    not a true protein
  7. 1639695Species Bacillus subtilis [TaxId:1423] [228697] (5 PDB entries)
  8. 1639743Domain d4lnnl1: 4lnn L:2-104 [253654]
    Other proteins in same PDB: d4lnna2, d4lnnb2, d4lnnc2, d4lnnd2, d4lnne2, d4lnnf2, d4lnng2, d4lnnh2, d4lnni2, d4lnnj2, d4lnnk2, d4lnnl2
    automated match to d4lnia1
    complexed with mg, so4

Details for d4lnnl1

PDB Entry: 4lnn (more details), 3.1 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of apo form of GS
PDB Compounds: (L:) glutamine synthetase

SCOPe Domain Sequences for d4lnnl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnnl1 d.15.9.0 (L:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

SCOPe Domain Coordinates for d4lnnl1:

Click to download the PDB-style file with coordinates for d4lnnl1.
(The format of our PDB-style files is described here.)

Timeline for d4lnnl1: