Lineage for d4lnng2 (4lnn G:105-444)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538589Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2538590Protein automated matches [227028] (5 species)
    not a true protein
  7. 2538591Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)
  8. 2538646Domain d4lnng2: 4lnn G:105-444 [253645]
    Other proteins in same PDB: d4lnna1, d4lnnb1, d4lnnc1, d4lnnd1, d4lnne1, d4lnnf1, d4lnng1, d4lnnh1, d4lnni1, d4lnnj1, d4lnnk1, d4lnnl1
    automated match to d4lnia2
    complexed with mg, so4

Details for d4lnng2

PDB Entry: 4lnn (more details), 3.1 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of apo form of GS
PDB Compounds: (G:) glutamine synthetase

SCOPe Domain Sequences for d4lnng2:

Sequence, based on SEQRES records: (download)

>d4lnng2 d.128.1.0 (G:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

Sequence, based on observed residues (ATOM records): (download)

>d4lnng2 d.128.1.0 (G:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsv
llaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnevmvkal
gehlfehfieakeiewdmfrtqvhpwereqymsqy

SCOPe Domain Coordinates for d4lnng2:

Click to download the PDB-style file with coordinates for d4lnng2.
(The format of our PDB-style files is described here.)

Timeline for d4lnng2: