SCOPe 2.07: Domain d1fvia1: 1fvi A:190-293

Lineage for d1fvia1 (1fvi A:190-293)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)

6. Protein ATP-dependent DNA ligase [50310] (2 species)

7. Species Chlorella virus PBCV-1 [TaxId:10506] [50312] (4 PDB entries)

8. Domain d1fvia1: 1fvi A:190-293 [25364]
   Other proteins in same PDB: d1fvia2
   complexed with amp, so4

Details for d1fvia1

PDB Entry: 1fvi, 2 Å

PDB Description: crystal structure of chlorella virus dna ligase-adenylate

PDB Compounds: (A:) chlorella virus DNA ligase-adenylate

SCOPe Domain Sequences for d1fvia1:

Sequence, based on SEQRES records:

>d1fvia1 b.40.4.6 (A:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigir

Sequence, based on observed residues (ATOM records):

>d1fvia1 b.40.4.6 (A:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfksgkveedvmgsievdydgvvfsigtgfdadqrrdfwqnkesyig
kmvkfkyfemprfpvfigir

Timeline for d1fvia1:

• d1fvia1 first appeared (with stable ids) in SCOP 1.55
  
• d1fvia1 appears in SCOPe 2.06
  
• d1fvia1 appears in the current release, SCOPe 2.08