Lineage for d1fvia1 (1fvi A:190-293)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14229Family b.40.4.6: DNA ligase/mRNA capping enzyme, domain 2 [50307] (3 proteins)
  6. 14230Protein ATP-dependent DNA ligase [50310] (2 species)
  7. 14233Species Chlorella virus, PBCV-1 [50312] (1 PDB entry)
  8. 14234Domain d1fvia1: 1fvi A:190-293 [25364]
    Other proteins in same PDB: d1fvia2

Details for d1fvia1

PDB Entry: 1fvi (more details), 2 Å

PDB Description: crystal structure of chlorella virus dna ligase-adenylate

SCOP Domain Sequences for d1fvia1:

Sequence, based on SEQRES records: (download)

>d1fvia1 b.40.4.6 (A:190-293) ATP-dependent DNA ligase {Chlorella virus, PBCV-1}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigir

Sequence, based on observed residues (ATOM records): (download)

>d1fvia1 b.40.4.6 (A:190-293) ATP-dependent DNA ligase {Chlorella virus, PBCV-1}
fkdaeatiismtalfksgkveedvmgsievdydgvvfsigtgfdadqrrdfwqnkesyig
kmvkfkyfemprfpvfigir

SCOP Domain Coordinates for d1fvia1:

Click to download the PDB-style file with coordinates for d1fvia1.
(The format of our PDB-style files is described here.)

Timeline for d1fvia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fvia2