Lineage for d1fvia1 (1fvi A:190-293)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383641Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 protein domains)
  6. 2383642Protein ATP-dependent DNA ligase [50310] (2 species)
  7. 2383645Species Chlorella virus PBCV-1 [TaxId:10506] [50312] (4 PDB entries)
  8. 2383646Domain d1fvia1: 1fvi A:190-293 [25364]
    Other proteins in same PDB: d1fvia2
    complexed with amp, so4

Details for d1fvia1

PDB Entry: 1fvi (more details), 2 Å

PDB Description: crystal structure of chlorella virus dna ligase-adenylate
PDB Compounds: (A:) chlorella virus DNA ligase-adenylate

SCOPe Domain Sequences for d1fvia1:

Sequence, based on SEQRES records: (download)

>d1fvia1 b.40.4.6 (A:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigir

Sequence, based on observed residues (ATOM records): (download)

>d1fvia1 b.40.4.6 (A:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfksgkveedvmgsievdydgvvfsigtgfdadqrrdfwqnkesyig
kmvkfkyfemprfpvfigir

SCOPe Domain Coordinates for d1fvia1:

Click to download the PDB-style file with coordinates for d1fvia1.
(The format of our PDB-style files is described here.)

Timeline for d1fvia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fvia2