Lineage for d4lnnc1 (4lnn C:2-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934938Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2934939Protein automated matches [226862] (5 species)
    not a true protein
  7. 2934940Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries)
  8. 2934985Domain d4lnnc1: 4lnn C:2-104 [253636]
    Other proteins in same PDB: d4lnna2, d4lnnb2, d4lnnc2, d4lnnd2, d4lnne2, d4lnnf2, d4lnng2, d4lnnh2, d4lnni2, d4lnnj2, d4lnnk2, d4lnnl2
    automated match to d4lnia1
    complexed with mg, so4

Details for d4lnnc1

PDB Entry: 4lnn (more details), 3.1 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of apo form of GS
PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d4lnnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnnc1 d.15.9.0 (C:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

SCOPe Domain Coordinates for d4lnnc1:

Click to download the PDB-style file with coordinates for d4lnnc1.
(The format of our PDB-style files is described here.)

Timeline for d4lnnc1: