SCOPe 2.08: Domain d4lnha1: 4lnh A:1-242

Lineage for d4lnha1 (4lnh A:1-242)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (46 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [226714] (4 PDB entries)

8. Domain d4lnha1: 4lnh A:1-242 [253631]
   Other proteins in same PDB: d4lnha2
   automated match to d2iscc_
   complexed with gol, so4

Details for d4lnha1

PDB Entry: 4lnh, 2.3 Å

PDB Description: crystal structure of uridine phosphorylase from vibrio fischeri es114, nysgrc target 29520.

PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d4lnha1:

Sequence, based on SEQRES records:

>d4lnha1 c.56.2.0 (A:1-242) automated matches {Vibrio fischeri [TaxId: 312309]}
mskqphicvdenqvspyvivcgepdrvnrivelmdnvellaenreyrvfngvykgttiti
cstgigapsmiiaveelklcgathvirvgsagamqdhiqlgelivaegavrdeggskayi
ssaypayasfallkeishflenqsvkyyfgvvrshdsfytdeedqlcqywnkkgilgadm
etsalftvgrlrglqvasilnnvvlyqqdvkegvnqyvndnkammngerlaaitaletlc
kq

Sequence, based on observed residues (ATOM records):

>d4lnha1 c.56.2.0 (A:1-242) automated matches {Vibrio fischeri [TaxId: 312309]}
mskqphicvdenqvspyvivcgepdrvnrivelmdnvellaenreyrvfngvykgttiti
cstgigapsmiiaveelklcgathvirvgsagamqdhiqlgelivaegavrdeggskayi
ssaypayasfallkeishflenqsvkyyfgvvrshdsfytdeedqlcqywnkkgilgadm
etsalftvgrlrglqvasilnnvvlyqvnqyvndnkammngerlaaitaletlckq

Timeline for d4lnha1:

• d4lnha1 first appeared in SCOPe 2.04, called d4lnha_
  
• d4lnha1 appears in SCOPe 2.07