Lineage for d4lnha1 (4lnh A:1-242)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2126300Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2126301Protein automated matches [190781] (41 species)
    not a true protein
  7. 2126565Species Vibrio fischeri [TaxId:312309] [226714] (4 PDB entries)
  8. 2126569Domain d4lnha1: 4lnh A:1-242 [253631]
    Other proteins in same PDB: d4lnha2
    automated match to d2iscc_
    complexed with gol, so4

Details for d4lnha1

PDB Entry: 4lnh (more details), 2.3 Å

PDB Description: crystal structure of uridine phosphorylase from vibrio fischeri es114, nysgrc target 29520.
PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d4lnha1:

Sequence, based on SEQRES records: (download)

>d4lnha1 c.56.2.0 (A:1-242) automated matches {Vibrio fischeri [TaxId: 312309]}
mskqphicvdenqvspyvivcgepdrvnrivelmdnvellaenreyrvfngvykgttiti
cstgigapsmiiaveelklcgathvirvgsagamqdhiqlgelivaegavrdeggskayi
ssaypayasfallkeishflenqsvkyyfgvvrshdsfytdeedqlcqywnkkgilgadm
etsalftvgrlrglqvasilnnvvlyqqdvkegvnqyvndnkammngerlaaitaletlc
kq

Sequence, based on observed residues (ATOM records): (download)

>d4lnha1 c.56.2.0 (A:1-242) automated matches {Vibrio fischeri [TaxId: 312309]}
mskqphicvdenqvspyvivcgepdrvnrivelmdnvellaenreyrvfngvykgttiti
cstgigapsmiiaveelklcgathvirvgsagamqdhiqlgelivaegavrdeggskayi
ssaypayasfallkeishflenqsvkyyfgvvrshdsfytdeedqlcqywnkkgilgadm
etsalftvgrlrglqvasilnnvvlyqvnqyvndnkammngerlaaitaletlckq

SCOPe Domain Coordinates for d4lnha1:

Click to download the PDB-style file with coordinates for d4lnha1.
(The format of our PDB-style files is described here.)

Timeline for d4lnha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lnha2