Lineage for d4ln7a_ (4ln7 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856940Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 1856941Protein PA N-terminal domain [254375] (5 species)
  7. 1856942Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries)
  8. 1856945Domain d4ln7a_: 4ln7 A: [253630]
    automated match to d3ebja_
    protein/RNA complex; complexed with 1zq, edo, mg, mn, so4

Details for d4ln7a_

PDB Entry: 4ln7 (more details), 1.73 Å

PDB Description: 5,6-bis(4-fluorophenyl)-3-hydroxy-2,5-dihydropyridin-2-one bound to influenza 2009 pH1N1 endonuclease
PDB Compounds: (A:) polymerase pa

SCOPe Domain Sequences for d4ln7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln7a_ c.52.1.34 (A:) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
gplgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfid
ergesiivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydyken
rfieigvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrl
ftirqemasrslwdsfrqserg

SCOPe Domain Coordinates for d4ln7a_:

Click to download the PDB-style file with coordinates for d4ln7a_.
(The format of our PDB-style files is described here.)

Timeline for d4ln7a_: