SCOPe 2.07: Domain d1a0ia1: 1a0i A:241-349

Lineage for d1a0ia1 (1a0i A:241-349)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)

6. Protein ATP-dependent DNA ligase [50310] (2 species)

7. Species Bacteriophage T7 [TaxId:10760] [50311] (1 PDB entry)

8. Domain d1a0ia1: 1a0i A:241-349 [25363]
   Other proteins in same PDB: d1a0ia2
   protein/DNA complex; complexed with atp

Details for d1a0ia1

PDB Entry: 1a0i, 2.6 Å

PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp

PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d1a0ia1:

Sequence, based on SEQRES records:

>d1a0ia1 b.40.4.6 (A:241-349) ATP-dependent DNA ligase {Bacteriophage T7 [TaxId: 10760]}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffspygigdndactinpydgwacqisymeetpdgslrhpsfvmfr

Sequence, based on observed residues (ATOM records):

>d1a0ia1 b.40.4.6 (A:241-349) ATP-dependent DNA ligase {Bacteriophage T7 [TaxId: 10760]}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffdactinpydgwacqisymeetpdgslrhpsfvmfr

Timeline for d1a0ia1:

• d1a0ia1 first appeared (with stable ids) in SCOP 1.55, called d1a0i_1
  
• d1a0ia1 appears in SCOPe 2.06
  
• d1a0ia1 appears in the current release, SCOPe 2.08