Lineage for d4lmfb3 (4lmf B:160-277)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777704Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2777705Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2777709Protein Complement C1S component [89258] (1 species)
  7. 2777710Species Human (Homo sapiens) [TaxId:9606] [89259] (3 PDB entries)
  8. 2777718Domain d4lmfb3: 4lmf B:160-277 [253623]
    Other proteins in same PDB: d4lmfa2, d4lmfb2, d4lmfc2, d4lmfd2
    automated match to d1nt0a2
    complexed with ca, na

Details for d4lmfb3

PDB Entry: 4lmf (more details), 2.92 Å

PDB Description: c1s cub1-egf-cub2
PDB Compounds: (B:) Complement C1s subcomponent heavy chain

SCOPe Domain Sequences for d4lmfb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmfb3 b.23.1.1 (B:160-277) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
csgdvftaligeiaspnypkpypensrceyqirlekgfqvvvtlrredfdveaadsagnc
ldslvfvagdrqfgpycghgfpgplnietksnaldiifqtdltgqkkgwklryhgdpm

SCOPe Domain Coordinates for d4lmfb3:

Click to download the PDB-style file with coordinates for d4lmfb3.
(The format of our PDB-style files is described here.)

Timeline for d4lmfb3: