Class b: All beta proteins [48724] (176 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) automatically mapped to Pfam PF00431 |
Family b.23.1.1: Spermadhesin, CUB domain [49855] (5 proteins) |
Protein Complement C1S component [89258] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89259] (3 PDB entries) |
Domain d4lmfa3: 4lmf A:160-277 [253620] Other proteins in same PDB: d4lmfa2, d4lmfb2, d4lmfc2, d4lmfd2 automated match to d1nt0a2 complexed with ca, na |
PDB Entry: 4lmf (more details), 2.92 Å
SCOPe Domain Sequences for d4lmfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lmfa3 b.23.1.1 (A:160-277) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} csgdvftaligeiaspnypkpypensrceyqirlekgfqvvvtlrredfdveaadsagnc ldslvfvagdrqfgpycghgfpgplnietksnaldiifqtdltgqkkgwklryhgdpm
Timeline for d4lmfa3: