SCOPe 2.07: Domain d1ckoa1: 1cko A:239-327

Lineage for d1ckoa1 (1cko A:239-327)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)

6. Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species)

7. Species Chlorella virus PBCV-1 [TaxId:10506] [50309] (3 PDB entries)

8. Domain d1ckoa1: 1cko A:239-327 [25362]
   Other proteins in same PDB: d1ckoa2
   protein/RNA complex; complexed with gp3, zn

Details for d1ckoa1

PDB Entry: 1cko, 3.1 Å

PDB Description: structure of mrna capping enzyme in complex with the cap analog gpppg

PDB Compounds: (A:) mRNA capping enzyme

SCOPe Domain Sequences for d1ckoa1:

Sequence; same for both SEQRES and ATOM records:

>d1ckoa1 b.40.4.6 (A:239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus PBCV-1 [TaxId: 10506]}
thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk
nqandrltyektllnieenitidelldlf

Timeline for d1ckoa1:

• d1ckoa1 first appeared (with stable ids) in SCOP 1.55, called d1cko_1
  
• d1ckoa1 appears in SCOPe 2.06
  
• d1ckoa1 appears in the current release, SCOPe 2.08