Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) |
Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species) |
Species Chlorella virus PBCV-1 [TaxId:10506] [50309] (3 PDB entries) |
Domain d1ckoa1: 1cko A:239-327 [25362] Other proteins in same PDB: d1ckoa2 protein/RNA complex; complexed with gp3, zn |
PDB Entry: 1cko (more details), 3.1 Å
SCOPe Domain Sequences for d1ckoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckoa1 b.40.4.6 (A:239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus PBCV-1 [TaxId: 10506]} thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk nqandrltyektllnieenitidelldlf
Timeline for d1ckoa1: