Lineage for d1ckoa1 (1cko A:239-327)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790201Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 2790227Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species)
  7. 2790228Species Chlorella virus PBCV-1 [TaxId:10506] [50309] (3 PDB entries)
  8. 2790233Domain d1ckoa1: 1cko A:239-327 [25362]
    Other proteins in same PDB: d1ckoa2
    protein/RNA complex; complexed with gp3, zn
    has additional insertions and/or extensions that are not grouped together

Details for d1ckoa1

PDB Entry: 1cko (more details), 3.1 Å

PDB Description: structure of mrna capping enzyme in complex with the cap analog gpppg
PDB Compounds: (A:) mRNA capping enzyme

SCOPe Domain Sequences for d1ckoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckoa1 b.40.4.6 (A:239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus PBCV-1 [TaxId: 10506]}
thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk
nqandrltyektllnieenitidelldlf

SCOPe Domain Coordinates for d1ckoa1:

Click to download the PDB-style file with coordinates for d1ckoa1.
(The format of our PDB-style files is described here.)

Timeline for d1ckoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ckoa2