Lineage for d1ckoa1 (1cko A:239-327)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) 
Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species) Species Chlorella virus PBCV-1 [TaxId:10506] [50309] (3 PDB entries) 
Domain d1ckoa1: 1cko A:239-327 [25362]
Other proteins in same PDB: d1ckoa2
protein/RNA complex; complexed with gp3, zn
has additional insertions and/or extensions that are not grouped together
Details for d1ckoa1
PDB Entry: 1cko (more details), 3.1 Å
PDB Description: structure of mrna capping enzyme in complex with the cap analog gpppg
PDB Compounds: (A:) mRNA capping enzymeSCOPe Domain Sequences for d1ckoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckoa1 b.40.4.6 (A:239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus PBCV-1 [TaxId: 10506]}
thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk
nqandrltyektllnieenitidelldlf
SCOPe Domain Coordinates for d1ckoa1:
Click to download the PDB-style file with coordinates for d1ckoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ckoa1:
- d1ckoa1 first appeared (with stable ids) in SCOP 1.55, called d1cko_1
- d1ckoa1 appears in SCOPe 2.07
View in 3D
