Lineage for d4lmfa1 (4lmf A:2-116)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532394Fold b.23: CUB-like [49853] (4 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1532395Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 1532396Family b.23.1.1: Spermadhesin, CUB domain [49855] (5 proteins)
  6. 1532400Protein Complement C1S component [89258] (1 species)
  7. 1532401Species Human (Homo sapiens) [TaxId:9606] [89259] (3 PDB entries)
  8. 1532406Domain d4lmfa1: 4lmf A:2-116 [253618]
    Other proteins in same PDB: d4lmfa2, d4lmfb2, d4lmfc2, d4lmfd2
    automated match to d1nt0a1
    complexed with ca, na

Details for d4lmfa1

PDB Entry: 4lmf (more details), 2.92 Å

PDB Description: c1s cub1-egf-cub2
PDB Compounds: (A:) Complement C1s subcomponent heavy chain

SCOPe Domain Sequences for d4lmfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmfa1 b.23.1.1 (A:2-116) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
ptmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgd
teegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatd

SCOPe Domain Coordinates for d4lmfa1:

Click to download the PDB-style file with coordinates for d4lmfa1.
(The format of our PDB-style files is described here.)

Timeline for d4lmfa1: