Lineage for d4lktd1 (4lkt D:1-135)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2072541Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2072703Protein Epidermal fatty acid binding protein [50854] (1 species)
  7. 2072704Species Human (Homo sapiens) [TaxId:9606] [50855] (6 PDB entries)
  8. 2072719Domain d4lktd1: 4lkt D:1-135 [253617]
    Other proteins in same PDB: d4lkta2, d4lktb2, d4lktc2, d4lktd2
    automated match to d4lkpa_
    complexed with cit, cl, eic, gol, nh4, so4, tar

Details for d4lktd1

PDB Entry: 4lkt (more details), 2.57 Å

PDB Description: crystal structure of human epidermal fatty acid binding protein (fabp5) in complex with linoleic acid
PDB Compounds: (D:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d4lktd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lktd1 b.60.1.2 (D:1-135) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
matvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestl
kttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvec
vmnnvtctriyekve

SCOPe Domain Coordinates for d4lktd1:

Click to download the PDB-style file with coordinates for d4lktd1.
(The format of our PDB-style files is described here.)

Timeline for d4lktd1: