SCOPe 2.08: Domain d4lkbc1: 4lkb C:1-120

Lineage for d4lkbc1 (4lkb C:1-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [256358] (1 PDB entry)

8. Domain d4lkbc1: 4lkb C:1-120 [253608]
   Other proteins in same PDB: d4lkba2, d4lkbb2, d4lkbc2, d4lkbd2, d4lkbf2
   automated match to d1mwwa_
   complexed with gol, so4

Details for d4lkbc1

PDB Entry: 4lkb, 2.16 Å

PDB Description: Crystal structure of a putative 4-Oxalocrotonate Tautomerase from Nostoc sp. PCC 7120

PDB Compounds: (C:) hypothetical protein alr4568/putative 4-Oxalocrotonate Tautomerase

SCOPe Domain Sequences for d4lkbc1:

Sequence; same for both SEQRES and ATOM records:

>d4lkbc1 d.80.1.0 (C:1-120) automated matches {Nostoc sp. [TaxId: 103690]}
mvqikvyglaeklnpikaelsnilhtslievlqispekrfhrffpldkldfyypsdrtdn
yliieiimfegrsvetkkqllrdifkkvdekfgisvydieitlfeipkqnwgirgipgde

Timeline for d4lkbc1:

• d4lkbc1 first appeared in SCOPe 2.04, called d4lkbc_
  
• d4lkbc1 appears in SCOPe 2.07