![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
![]() | Protein automated matches [190903] (22 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [256358] (1 PDB entry) |
![]() | Domain d4lkbb1: 4lkb B:1-120 [253607] Other proteins in same PDB: d4lkba2, d4lkbb2, d4lkbc2, d4lkbd2, d4lkbf2 automated match to d1mwwa_ complexed with gol, so4 |
PDB Entry: 4lkb (more details), 2.16 Å
SCOPe Domain Sequences for d4lkbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkbb1 d.80.1.0 (B:1-120) automated matches {Nostoc sp. [TaxId: 103690]} mvqikvyglaeklnpikaelsnilhtslievlqispekrfhrffpldkldfyypsdrtdn yliieiimfegrsvetkkqllrdifkkvdekfgisvydieitlfeipkqnwgirgipgde
Timeline for d4lkbb1: