Lineage for d4lj2b_ (4lj2 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009030Fold d.258: Chorismate synthase, AroC [103262] (1 superfamily)
    duplication: consists of two DCoH-like beta(2)-alpha-beta(2)-alpha structural repeats; 3 layers, beta/alpha/beta
  4. 3009031Superfamily d.258.1: Chorismate synthase, AroC [103263] (2 families) (S)
  5. 3009032Family d.258.1.1: Chorismate synthase, AroC [103264] (2 proteins)
    automatically mapped to Pfam PF01264
  6. 3009033Protein Chorismate synthase, AroC [103265] (7 species)
  7. 3009034Species Acinetobacter baumannii [TaxId:575584] [236258] (3 PDB entries)
  8. 3009040Domain d4lj2b_: 4lj2 B: [253605]
    automated match to d4o90b_

Details for d4lj2b_

PDB Entry: 4lj2 (more details), 3.15 Å

PDB Description: Crystal structure of chorismate synthase from Acinetobacter baumannii at 3.15A resolution
PDB Compounds: (B:) Chorismate synthase

SCOPe Domain Sequences for d4lj2b_:

Sequence, based on SEQRES records: (download)

>d4lj2b_ d.258.1.1 (B:) Chorismate synthase, AroC {Acinetobacter baumannii [TaxId: 575584]}
magnsigqlfrvttcgeshgvglmaivdgvppglalteedlqkdldrrkpgtskfatqrk
epdqveiisgvfegkttgtpigllirntdqkskdygniaqtfrpghadytytqkygfrdy
rgggrssaretamrvaagaiakkylaekfgvlirghvtqignevaekldwnevpnnpffc
gdvdavprfealvtslreqgtscgakleilaekvpvgwgepvfdrldadiahammsinav
kgveigdgfavagqfghetrdeltshgflanhaggilggissgqtirvaialkptasitt
pgktinlnredtdvltkgrhdpcvgvratpiaeamlaivlmdhflrhraqnadvvppfap
iep

Sequence, based on observed residues (ATOM records): (download)

>d4lj2b_ d.258.1.1 (B:) Chorismate synthase, AroC {Acinetobacter baumannii [TaxId: 575584]}
magnsigqlfrvttcgeshgvglmaivdgvppglalteedlqkdldrrkpgtskfatqrk
epdqveiisgvfegkttgtpigllirntdqkskrdyrgggrssaretamrvaagaiakky
laekfgvlirghvtqignevaekldwnevpnnpffcgdvdavprfealvtslreqgtscg
akleilaekvpvgwgepvfdrldadiahammsinavkgveigdgfavagqfghetrdelt
shgflanhaggilggissgqtirvaialkptasitttkgrhdpcvgvratpiaeamlaiv
lmdhflrhraqnadvvppfapiep

SCOPe Domain Coordinates for d4lj2b_:

Click to download the PDB-style file with coordinates for d4lj2b_.
(The format of our PDB-style files is described here.)

Timeline for d4lj2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4lj2a_