Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Aspergillus nidulans [TaxId:227321] [256357] (1 PDB entry) |
Domain d4lisb_: 4lis B: [253603] automated match to d1orra_ complexed with gol, iod, nad, udp, upg |
PDB Entry: 4lis (more details), 2.8 Å
SCOPe Domain Sequences for d4lisb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lisb_ c.2.1.0 (B:) automated matches {Aspergillus nidulans [TaxId: 227321]} sgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaqldv tdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnvtn ivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakkag neteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgddy ashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafskavg rdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqqpp ael
Timeline for d4lisb_: