Lineage for d4lisb_ (4lis B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845951Species Aspergillus nidulans [TaxId:227321] [256357] (1 PDB entry)
  8. 2845953Domain d4lisb_: 4lis B: [253603]
    automated match to d1orra_
    complexed with gol, iod, nad, udp, upg

Details for d4lisb_

PDB Entry: 4lis (more details), 2.8 Å

PDB Description: Crystal Structure of UDP-galactose-4-epimerase from Aspergillus nidulans
PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d4lisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lisb_ c.2.1.0 (B:) automated matches {Aspergillus nidulans [TaxId: 227321]}
sgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaqldv
tdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnvtn
ivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakkag
neteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgddy
ashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafskavg
rdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqqpp
ael

SCOPe Domain Coordinates for d4lisb_:

Click to download the PDB-style file with coordinates for d4lisb_.
(The format of our PDB-style files is described here.)

Timeline for d4lisb_: