SCOPe 2.05: Domain d4lirb_: 4lir B:

Lineage for d4lirb_ (4lir B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)

8. Domain d4lirb_: 4lir B: [253602]
   automated match to d1wwha1

Details for d4lirb_

PDB Entry: 4lir, 2.46 Å

PDB Description: crystal structure of a nucleoporin 35kda (nup35) from homo sapiens at 2.46 a resolution

PDB Compounds: (B:) Nucleoporin NUP53

SCOPe Domain Sequences for d4lirb_:

Sequence; same for both SEQRES and ATOM records:

>d4lirb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhlddswvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskd
grifgesimigvkpcidksvmess

Timeline for d4lirb_:

• d4lirb_ first appeared in SCOPe 2.04
  
• d4lirb_ appears in SCOPe 2.06
  
• d4lirb_ appears in the current release, SCOPe 2.08