Lineage for d4lira_ (4lir A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908892Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)
  8. 1908925Domain d4lira_: 4lir A: [253601]
    automated match to d1wwha1

Details for d4lira_

PDB Entry: 4lir (more details), 2.46 Å

PDB Description: crystal structure of a nucleoporin 35kda (nup35) from homo sapiens at 2.46 a resolution
PDB Compounds: (A:) Nucleoporin NUP53

SCOPe Domain Sequences for d4lira_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lira_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lddswvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgr
ifgesimigvkpcidksvme

SCOPe Domain Coordinates for d4lira_:

Click to download the PDB-style file with coordinates for d4lira_.
(The format of our PDB-style files is described here.)

Timeline for d4lira_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4lirb_