Lineage for d1ckna1 (1ckn A:239-327)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789562Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 1789587Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species)
  7. 1789588Species Chlorella virus PBCV-1 [TaxId:10506] [50309] (3 PDB entries)
  8. 1789591Domain d1ckna1: 1ckn A:239-327 [25360]
    Other proteins in same PDB: d1ckna2, d1cknb2
    protein/RNA complex; complexed with gtp, mn, so4

Details for d1ckna1

PDB Entry: 1ckn (more details), 2.5 Å

PDB Description: structure of guanylylated mrna capping enzyme complexed with gtp
PDB Compounds: (A:) mRNA capping enzyme

SCOPe Domain Sequences for d1ckna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckna1 b.40.4.6 (A:239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus PBCV-1 [TaxId: 10506]}
thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk
nqandrltyektllnieenitidelldlf

SCOPe Domain Coordinates for d1ckna1:

Click to download the PDB-style file with coordinates for d1ckna1.
(The format of our PDB-style files is described here.)

Timeline for d1ckna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ckna2