Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [236250] (5 PDB entries) |
Domain d4lihe_: 4lih E: [253597] automated match to d4o6rb_ complexed with edo, mes |
PDB Entry: 4lih (more details), 1.85 Å
SCOPe Domain Sequences for d4lihe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lihe_ c.82.1.0 (E:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} ltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaav aaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvpg aaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpala agnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaftg stavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemcta gsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrgeg rlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandte yglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhale kytelkstlirlr
Timeline for d4lihe_: