Lineage for d4lihb_ (4lih B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141177Species Burkholderia cenocepacia [TaxId:216591] [236250] (5 PDB entries)
  8. 2141179Domain d4lihb_: 4lih B: [253594]
    automated match to d4o6rb_
    complexed with edo, mes

Details for d4lihb_

PDB Entry: 4lih (more details), 1.85 Å

PDB Description: The crystal structure of Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase from Burkholderia cenocepacia J2315
PDB Compounds: (B:) Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase

SCOPe Domain Sequences for d4lihb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lihb_ c.82.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
ltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaav
aaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvpg
aaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpala
agnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaftg
stavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemcta
gsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrgeg
rlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandte
yglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhale
kytelkstlirlr

SCOPe Domain Coordinates for d4lihb_:

Click to download the PDB-style file with coordinates for d4lihb_.
(The format of our PDB-style files is described here.)

Timeline for d4lihb_: