SCOPe 2.08: Domain d4lhyb_: 4lhy B:

Lineage for d4lhyb_ (4lhy B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab8a [142293] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254870] (14 PDB entries)

8. Domain d4lhyb_: 4lhy B: [253592]
   automated match to d1zbda_
   complexed with gdp, so4

Details for d4lhyb_

PDB Entry: 4lhy, 3.1 Å

PDB Description: Crystal structure of GDP-bound Rab8:Rabin8

PDB Compounds: (B:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d4lhyb_:

Sequence; same for both SEQRES and ATOM records:

>d4lhyb_ c.37.1.8 (B:) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
ktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkkl

Timeline for d4lhyb_:

• d4lhyb_ first appeared in SCOPe 2.04
  
• d4lhyb_ appears in SCOPe 2.07