Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) |
Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species) |
Species Chlorella virus PBCV-1 [TaxId:10506] [50309] (3 PDB entries) |
Domain d1ckmb1: 1ckm B:239-327 [25359] Other proteins in same PDB: d1ckma2, d1ckmb2 protein/RNA complex; complexed with gtp has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ckm (more details), 2.5 Å
SCOPe Domain Sequences for d1ckmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckmb1 b.40.4.6 (B:239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus PBCV-1 [TaxId: 10506]} thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk nqandrltyektllnieenitidelldlf
Timeline for d1ckmb1: