![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [256133] (11 PDB entries) |
![]() | Domain d4lh2a_: 4lh2 A: [253585] Other proteins in same PDB: d4lh2b2 automated match to d4oe5a_ complexed with 1pe, sin |
PDB Entry: 4lh2 (more details), 1.67 Å
SCOPe Domain Sequences for d4lh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lh2a_ c.82.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiqyqlspfnhah kvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgprraevlaktmv gqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrglegfvaaisp fnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgptf gdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggknfhfvhssadv dsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvgdpaedfgtffs avidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdpqepimkeeif gpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrnaagnfyindk stgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwrysymq
Timeline for d4lh2a_: