Lineage for d4lh0b1 (4lh0 B:22-563)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141334Species Mouse (Mus musculus) [TaxId:10090] [256133] (9 PDB entries)
  8. 2141344Domain d4lh0b1: 4lh0 B:22-563 [253582]
    Other proteins in same PDB: d4lh0b2
    automated match to d4oe5a_
    complexed with 1pe, glv

Details for d4lh0b1

PDB Entry: 4lh0 (more details), 1.67 Å

PDB Description: Structure of mouse 1-Pyrroline-5-Carboxylate Dehydrogenase (ALDH4A1) complexed with glyoxylate
PDB Compounds: (B:) Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4lh0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lh0b1 c.82.1.0 (B:22-563) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lrwkhtsslkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiqyq
lspfnhahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgprra
evlaktmvgqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrgle
gfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqf
vpadgptfgdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggknfh
fvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvgdpa
edfgtffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdpqe
pimkeeifgpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrnaa
gnfyindkstgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwrysy
mq

SCOPe Domain Coordinates for d4lh0b1:

Click to download the PDB-style file with coordinates for d4lh0b1.
(The format of our PDB-style files is described here.)

Timeline for d4lh0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lh0b2
View in 3D
Domains from other chains:
(mouse over for more information)
d4lh0a_