Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (59 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [256133] (11 PDB entries) |
Domain d4lgza_: 4lgz A: [253579] Other proteins in same PDB: d4lgzb2 automated match to d4oe5a_ complexed with 1pe, acy |
PDB Entry: 4lgz (more details), 1.68 Å
SCOPe Domain Sequences for d4lgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lgza_ c.82.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiqyqlspfnhahk vakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgprraevlaktmvg qgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrglegfvaaispf nftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgptfg dtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggknfhfvhssadvd svvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvgdpaedfgtffsa vidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdpqepimkeeifg pvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrnaagnfyindks tgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwrysymq
Timeline for d4lgza_: