Lineage for d4lfya_ (4lfy A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084960Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2084961Protein automated matches [190150] (26 species)
    not a true protein
  7. 2084972Species Burkholderia cenocepacia [TaxId:216591] [256356] (1 PDB entry)
  8. 2084973Domain d4lfya_: 4lfy A: [253577]
    automated match to d2eg6a_
    complexed with ca, edo, zn

Details for d4lfya_

PDB Entry: 4lfy (more details), 1.8 Å

PDB Description: crystal structure of a dihydroorotase from burkholderia cenocepacia j2315
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d4lfya_:

Sequence, based on SEQRES records: (download)

>d4lfya_ c.1.9.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
ppmtasnasspatlslarpddwhlhlrdgdmlaavlphtarqfgraivmpnlkppvttta
qaqayrerilaalpagmtfeplmtlyltdntppdeirraresgfvhgvklypagattnsd
hgvtdlakcaktleamqetgmpllvhgevtdasidlfdrekvfidrvmtplrrdfpglkv
vfehittkdaadyvrdadaapgllgatitahhllynrnalfvggirphyyclpvlkreth
rvalveaatsgnprfflgtdsaphardaketacgcagcytalhalelyaeafdtagaldk
legfasffgadfyglprsaetvtlrrepwelpreifagetpvvplrggetigwkla

Sequence, based on observed residues (ATOM records): (download)

>d4lfya_ c.1.9.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
ppmtasnspatlslarpddwhlhlrdgdmlaavlphtarqfgraivmpnlkppvtttaqa
qayrerilaalpagmtfeplmtlyltdntppdeirraresgfvhgvklypasdhgvtdla
kcaktleamqetgmpllvhgevtdasidlfdrekvfidrvmtplrrdfpglkvvfehitt
kdaadyvrdadaapgllgatitahhllynrnalfvggirphyyclpvlkrethrvalvea
atsgnprfflgtdsaphardaketacgcagcytalhalelyaeafdtagaldklegfasf
fgadfyglprsaetvtlrrepwelpreifagetpvvplrggetigwkla

SCOPe Domain Coordinates for d4lfya_:

Click to download the PDB-style file with coordinates for d4lfya_.
(The format of our PDB-style files is described here.)

Timeline for d4lfya_: