Lineage for d4le6c_ (4le6 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231881Species Pseudomonas pseudoalcaligenes [TaxId:330] [256354] (1 PDB entry)
  8. 2231884Domain d4le6c_: 4le6 C: [253572]
    automated match to d1p9ea_
    complexed with edo, gol, pge, zn

Details for d4le6c_

PDB Entry: 4le6 (more details), 2.1 Å

PDB Description: Crystal structure of the phosphotriesterase OPHC2 from Pseudomonas pseudoalcaligenes
PDB Compounds: (C:) Organophosphorus hydrolase

SCOPe Domain Sequences for d4le6c_:

Sequence, based on SEQRES records: (download)

>d4le6c_ d.157.1.0 (C:) automated matches {Pseudomonas pseudoalcaligenes [TaxId: 330]}
apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
cglvnadgspaypnatvevpqaeaefwldeatmakapegmqgmfkmaqqavapyakmnkl
kpyktegellpgvslvaspghtpghtsylfksggqsllvwgdillnhavqfakpevvfef
dvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqgyawvpvefspirsdr

Sequence, based on observed residues (ATOM records): (download)

>d4le6c_ d.157.1.0 (C:) automated matches {Pseudomonas pseudoalcaligenes [TaxId: 330]}
apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
cglvnadgspaypnatvevpqaellpgvslvaspghtpghtsylfksggqsllvwgdill
nhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqgy
awvpvefspirsdr

SCOPe Domain Coordinates for d4le6c_:

Click to download the PDB-style file with coordinates for d4le6c_.
(The format of our PDB-style files is described here.)

Timeline for d4le6c_: