Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Pseudomonas pseudoalcaligenes [TaxId:330] [256354] (1 PDB entry) |
Domain d4le6b_: 4le6 B: [253571] automated match to d1p9ea_ complexed with edo, gol, pge, zn |
PDB Entry: 4le6 (more details), 2.1 Å
SCOPe Domain Sequences for d4le6b_:
Sequence, based on SEQRES records: (download)
>d4le6b_ d.157.1.0 (B:) automated matches {Pseudomonas pseudoalcaligenes [TaxId: 330]} aapaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekg vqtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdh acglvnadgspaypnatvevpqaeaefwldeatmakapegmqgmfkmaqqavapyakmnk lkpyktegellpgvslvaspghtpghtsylfksggqsllvwgdillnhavqfakpevvfe fdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqgyawvpvefspirsdr
>d4le6b_ d.157.1.0 (B:) automated matches {Pseudomonas pseudoalcaligenes [TaxId: 330]} aapaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekg vqtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdh acglvnadgspaypnatvevpqaellpgvslvaspghtpghtsylfksggqsllvwgdil lnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqg yawvpvefspirsdr
Timeline for d4le6b_:
View in 3D Domains from other chains: (mouse over for more information) d4le6a_, d4le6c_, d4le6d_, d4le6e_ |