![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Pseudomonas pseudoalcaligenes [TaxId:330] [256354] (1 PDB entry) |
![]() | Domain d4le6a_: 4le6 A: [253570] automated match to d1p9ea_ complexed with edo, gol, pge, zn |
PDB Entry: 4le6 (more details), 2.1 Å
SCOPe Domain Sequences for d4le6a_:
Sequence, based on SEQRES records: (download)
>d4le6a_ d.157.1.0 (A:) automated matches {Pseudomonas pseudoalcaligenes [TaxId: 330]} aapaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekg vqtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdh acglvnadgspaypnatvevpqaeaefwldeatmakapegmqgmfkmaqqavapyakmnk lkpyktegellpgvslvaspghtpghtsylfksggqsllvwgdillnhavqfakpevvfe fdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqgyawvpvefspirsdr
>d4le6a_ d.157.1.0 (A:) automated matches {Pseudomonas pseudoalcaligenes [TaxId: 330]} aapaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekg vqtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdh acglvnadgspaypnatvevpqaegellpgvslvaspghtpghtsylfksggqsllvwgd illnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkea qgyawvpvefspirsdr
Timeline for d4le6a_:
![]() Domains from other chains: (mouse over for more information) d4le6b_, d4le6c_, d4le6d_, d4le6e_ |