Lineage for d1rip__ (1rip -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14165Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins)
  6. 14207Protein Ribosomal protein S17 [50304] (2 species)
  7. 14208Species Bacillus stearothermophilus [TaxId:1422] [50306] (1 PDB entry)
  8. 14209Domain d1rip__: 1rip - [25357]

Details for d1rip__

PDB Entry: 1rip (more details)

PDB Description: ribosomal protein s17: characterization of the three-dimensional structure by 1h-and 15n-nmr

SCOP Domain Sequences for d1rip__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rip__ b.40.4.5 (-) Ribosomal protein S17 {Bacillus stearothermophilus}
qrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdivkime
trplsatkrfrlveivekavr

SCOP Domain Coordinates for d1rip__:

Click to download the PDB-style file with coordinates for d1rip__.
(The format of our PDB-style files is described here.)

Timeline for d1rip__: