Lineage for d4le5b3 (4le5 B:244-398)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215558Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2215559Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2215664Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2215665Protein automated matches [254617] (10 species)
    not a true protein
  7. 2215678Species Campylobacter jejuni [TaxId:195099] [256355] (1 PDB entry)
  8. 2215684Domain d4le5b3: 4le5 B:244-398 [253569]
    Other proteins in same PDB: d4le5a4
    automated match to d1mxaa3

Details for d4le5b3

PDB Entry: 4le5 (more details), 1.7 Å

PDB Description: Structure of an Unusual S-adenosylmethionine synthetase from Campylobacter jejuni
PDB Compounds: (B:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d4le5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4le5b3 d.130.1.0 (B:244-398) automated matches {Campylobacter jejuni [TaxId: 195099]}
nhsslhdsgltgrklivdsfggyspigggaqsskdytkvdrsglyagrwlaknivaagla
kkcivqlsyaigvakptsvsvdcmgtntsvnddvlsdfvmqnfsltpnwirdkfhldkps
ketflyadvaargqvgqkdypwekldaleqfkkll

SCOPe Domain Coordinates for d4le5b3:

Click to download the PDB-style file with coordinates for d4le5b3.
(The format of our PDB-style files is described here.)

Timeline for d4le5b3: