![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.31: EV matrix protein [50011] (1 superfamily) consists of two beta-sandwich domains of similar topologies |
![]() | Superfamily b.31.1: EV matrix protein [50012] (2 families) ![]() |
![]() | Family b.31.1.1: EV matrix protein [50013] (2 proteins) |
![]() | Protein automated matches [227095] (4 species) not a true protein |
![]() | Species Ebola virus [TaxId:186538] [256353] (2 PDB entries) |
![]() | Domain d4ldma_: 4ldm A: [253563] automated match to d1h2da_ |
PDB Entry: 4ldm (more details), 1.85 Å
SCOPe Domain Sequences for d4ldma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ldma_ b.31.1.1 (A:) automated matches {Ebola virus [TaxId: 186538]} vssafileamvnvisgpkvlmkqipiwlplgvadqktysfdsttaaimlasytithfgka tnplvrvnrlgpgipdhplrllrignqaflqefvlppvqlpqyftfdltalklitqplpa
Timeline for d4ldma_: