Lineage for d4ldma_ (4ldm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782271Fold b.31: EV matrix protein [50011] (1 superfamily)
    consists of two beta-sandwich domains of similar topologies
  4. 2782272Superfamily b.31.1: EV matrix protein [50012] (2 families) (S)
  5. 2782273Family b.31.1.1: EV matrix protein [50013] (2 proteins)
  6. 2782281Protein automated matches [227095] (4 species)
    not a true protein
  7. 2782282Species Ebola virus [TaxId:186538] [256353] (2 PDB entries)
  8. 2782283Domain d4ldma_: 4ldm A: [253563]
    automated match to d1h2da_

Details for d4ldma_

PDB Entry: 4ldm (more details), 1.85 Å

PDB Description: Crystal Structure of an RNA-free VP40 Octameric Ring
PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d4ldma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ldma_ b.31.1.1 (A:) automated matches {Ebola virus [TaxId: 186538]}
vssafileamvnvisgpkvlmkqipiwlplgvadqktysfdsttaaimlasytithfgka
tnplvrvnrlgpgipdhplrllrignqaflqefvlppvqlpqyftfdltalklitqplpa

SCOPe Domain Coordinates for d4ldma_:

Click to download the PDB-style file with coordinates for d4ldma_.
(The format of our PDB-style files is described here.)

Timeline for d4ldma_: