SCOPe 2.08: Domain d4ldlb1: 4ldl B:6-120

Lineage for d4ldlb1 (4ldl B:6-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4ldlb1: 4ldl B:6-120 [253562]
   Other proteins in same PDB: d4ldlb2
   automated match to d4ldeb_
   complexed with 1wv, na, xqc

Details for d4ldlb1

PDB Entry: 4ldl, 3.1 Å

PDB Description: structure of beta2 adrenoceptor bound to hydroxybenzylisoproterenol and an engineered nanobody

PDB Compounds: (B:) Camelid Antibody Fragment

SCOPe Domain Sequences for d4ldlb1:

Sequence; same for both SEQRES and ATOM records:

>d4ldlb1 b.1.1.1 (B:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttnyansvkg
rftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvss

Timeline for d4ldlb1:

• d4ldlb1 first appeared in SCOPe 2.04, called d4ldlb_
  
• d4ldlb1 appears in SCOPe 2.07