SCOP 1.59: Domain d1hnxq_: 1hnx Q:

Lineage for d1hnxq_ (1hnx Q:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins)

6. Protein Ribosomal protein S17 [50304] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries)

8. Domain d1hnxq_: 1hnx Q: [25356]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxq_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxq_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

Timeline for d1hnxq_:

• d1hnxq_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxq_ appears in SCOP 1.57
  
• d1hnxq_ appears in SCOP 1.61
  
• d1hnxq_ appears in the current release, SCOPe 2.08