SCOPe 2.08: Domain d4ldbb2: 4ldb B:201-315

Lineage for d4ldbb2 (4ldb B:201-315)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.31: EV matrix protein [50011] (1 superfamily)
   consists of two beta-sandwich domains of similar topologies

4. Superfamily b.31.1: EV matrix protein [50012] (2 families)

5. Family b.31.1.1: EV matrix protein [50013] (2 proteins)

6. Protein automated matches [227095] (4 species)
   not a true protein

7. Species Ebola virus [TaxId:186538] [256353] (2 PDB entries)

8. Domain d4ldbb2: 4ldb B:201-315 [253559]
   automated match to d1es6a2

Details for d4ldbb2

PDB Entry: 4ldb, 3.1 Å

PDB Description: Crystal Structure of Ebola Virus VP40 Dimer

PDB Compounds: (B:) matrix protein vp40

SCOPe Domain Sequences for d4ldbb2:

Sequence, based on SEQRES records:

>d4ldbb2 b.31.1.1 (B:201-315) automated matches {Ebola virus [TaxId: 186538]}
galrpgisfhpklrpillpnksgkkgnsadltspekiqaimtslqdfkivpidptknimg
ievpetlvhkltgkkvtskngqpiipvllpkyigldpvapgdltmvitqdcdtch

Sequence, based on observed residues (ATOM records):

>d4ldbb2 b.31.1.1 (B:201-315) automated matches {Ebola virus [TaxId: 186538]}
galrpgisfhpklrpillpnltspekiqaimtslqdfkivpidptknimgievpetlvhk
ltgkkvtskngqpiipvllpkyiggdltmvitqdcdtch

Timeline for d4ldbb2:

• d4ldbb2 first appeared in SCOPe 2.04
  
• d4ldbb2 appears in SCOPe 2.07