Lineage for d4ldbb1 (4ldb B:44-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782271Fold b.31: EV matrix protein [50011] (1 superfamily)
    consists of two beta-sandwich domains of similar topologies
  4. 2782272Superfamily b.31.1: EV matrix protein [50012] (2 families) (S)
  5. 2782273Family b.31.1.1: EV matrix protein [50013] (2 proteins)
  6. 2782281Protein automated matches [227095] (4 species)
    not a true protein
  7. 2782282Species Ebola virus [TaxId:186538] [256353] (2 PDB entries)
  8. 2782286Domain d4ldbb1: 4ldb B:44-193 [253558]
    automated match to d1es6a1

Details for d4ldbb1

PDB Entry: 4ldb (more details), 3.1 Å

PDB Description: Crystal Structure of Ebola Virus VP40 Dimer
PDB Compounds: (B:) matrix protein vp40

SCOPe Domain Sequences for d4ldbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ldbb1 b.31.1.1 (B:44-193) automated matches {Ebola virus [TaxId: 186538]}
gdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmkqipiwlplgvadq
ktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrllrignqaflqefvl
ppvqlpqyftfdltalklitqplpaatwtd

SCOPe Domain Coordinates for d4ldbb1:

Click to download the PDB-style file with coordinates for d4ldbb1.
(The format of our PDB-style files is described here.)

Timeline for d4ldbb1: