SCOPe 2.05: Domain d4ldba2: 4ldb A:196-319

Lineage for d4ldba2 (4ldb A:196-319)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.31: EV matrix protein [50011] (1 superfamily)
   consists of two beta-sandwich domains of similar topologies

4. Superfamily b.31.1: EV matrix protein [50012] (2 families)

5. Family b.31.1.1: EV matrix protein [50013] (2 proteins)

6. Protein automated matches [227095] (3 species)
   not a true protein

7. Species Ebola virus [TaxId:186538] [256353] (2 PDB entries)

8. Domain d4ldba2: 4ldb A:196-319 [253557]
   automated match to d1es6a2

Details for d4ldba2

PDB Entry: 4ldb, 3.1 Å

PDB Description: Crystal Structure of Ebola Virus VP40 Dimer

PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d4ldba2:

Sequence, based on SEQRES records:

>d4ldba2 b.31.1.1 (A:196-319) automated matches {Ebola virus [TaxId: 186538]}
ptgsngalrpgisfhpklrpillpnksgkkgnsadltspekiqaimtslqdfkivpidpt
knimgievpetlvhkltgkkvtskngqpiipvllpkyigldpvapgdltmvitqdcdtch
spas

Sequence, based on observed residues (ATOM records):

>d4ldba2 b.31.1.1 (A:196-319) automated matches {Ebola virus [TaxId: 186538]}
ptgsngalrpgisfhpklrpillpnkltspekiqaimtslqdfkivpidptknimgievp
etlvhkltgkkvtskngqpiipvllpkyigldpvapgdltmvitqdcdtchspas

Timeline for d4ldba2:

• d4ldba2 first appeared in SCOPe 2.04
  
• d4ldba2 appears in SCOPe 2.06
  
• d4ldba2 appears in the current release, SCOPe 2.08