![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.31: EV matrix protein [50011] (1 superfamily) consists of two beta-sandwich domains of similar topologies |
![]() | Superfamily b.31.1: EV matrix protein [50012] (2 families) ![]() |
![]() | Family b.31.1.1: EV matrix protein [50013] (2 proteins) |
![]() | Protein automated matches [227095] (4 species) not a true protein |
![]() | Species Ebola virus [TaxId:186538] [256353] (2 PDB entries) |
![]() | Domain d4ldba2: 4ldb A:196-319 [253557] automated match to d1es6a2 |
PDB Entry: 4ldb (more details), 3.1 Å
SCOPe Domain Sequences for d4ldba2:
Sequence, based on SEQRES records: (download)
>d4ldba2 b.31.1.1 (A:196-319) automated matches {Ebola virus [TaxId: 186538]} ptgsngalrpgisfhpklrpillpnksgkkgnsadltspekiqaimtslqdfkivpidpt knimgievpetlvhkltgkkvtskngqpiipvllpkyigldpvapgdltmvitqdcdtch spas
>d4ldba2 b.31.1.1 (A:196-319) automated matches {Ebola virus [TaxId: 186538]} ptgsngalrpgisfhpklrpillpnkltspekiqaimtslqdfkivpidptknimgievp etlvhkltgkkvtskngqpiipvllpkyigldpvapgdltmvitqdcdtchspas
Timeline for d4ldba2:
![]() Domains from other chains: (mouse over for more information) d4ldbb1, d4ldbb2, d4ldbc1, d4ldbd1 |