Lineage for d4ldba1 (4ldb A:44-194)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045265Fold b.31: EV matrix protein [50011] (1 superfamily)
    consists of two beta-sandwich domains of similar topologies
  4. 2045266Superfamily b.31.1: EV matrix protein [50012] (2 families) (S)
  5. 2045267Family b.31.1.1: EV matrix protein [50013] (2 protein domains)
  6. 2045275Protein automated matches [227095] (3 species)
    not a true protein
  7. 2045276Species Ebola virus [TaxId:186538] [256353] (2 PDB entries)
  8. 2045278Domain d4ldba1: 4ldb A:44-194 [253556]
    automated match to d1es6a1

Details for d4ldba1

PDB Entry: 4ldb (more details), 3.1 Å

PDB Description: Crystal Structure of Ebola Virus VP40 Dimer
PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d4ldba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ldba1 b.31.1.1 (A:44-194) automated matches {Ebola virus [TaxId: 186538]}
gdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmkqipiwlplgvadq
ktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrllrignqaflqefvl
ppvqlpqyftfdltalklitqplpaatwtdd

SCOPe Domain Coordinates for d4ldba1:

Click to download the PDB-style file with coordinates for d4ldba1.
(The format of our PDB-style files is described here.)

Timeline for d4ldba1: