| Class b: All beta proteins [48724] (180 folds) |
| Fold b.31: EV matrix protein [50011] (1 superfamily) consists of two beta-sandwich domains of similar topologies |
Superfamily b.31.1: EV matrix protein [50012] (2 families) ![]() |
| Family b.31.1.1: EV matrix protein [50013] (2 proteins) |
| Protein automated matches [227095] (4 species) not a true protein |
| Species Ebola virus [TaxId:186538] [256353] (2 PDB entries) |
| Domain d4ldba1: 4ldb A:44-194 [253556] automated match to d1es6a1 |
PDB Entry: 4ldb (more details), 3.1 Å
SCOPe Domain Sequences for d4ldba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ldba1 b.31.1.1 (A:44-194) automated matches {Ebola virus [TaxId: 186538]}
gdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmkqipiwlplgvadq
ktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrllrignqaflqefvl
ppvqlpqyftfdltalklitqplpaatwtdd
Timeline for d4ldba1:
View in 3DDomains from other chains: (mouse over for more information) d4ldbb1, d4ldbb2, d4ldbc1, d4ldbd1 |