Lineage for d4lc0a1 (4lc0 A:3-212)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1847370Species Thermus thermophilus [TaxId:274] [256283] (6 PDB entries)
  8. 1847374Domain d4lc0a1: 4lc0 A:3-212 [253545]
    Other proteins in same PDB: d4lc0a2, d4lc0a3
    automated match to d1b23p3
    complexed with gnp, mg, nh4, so4

Details for d4lc0a1

PDB Entry: 4lc0 (more details), 2.22 Å

PDB Description: Identifying ligand binding hot spots in proteins using brominated fragments
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d4lc0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lc0a1 c.37.1.8 (A:3-212) automated matches {Thermus thermophilus [TaxId: 274]}
gefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargit
intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
hrnpktrrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d4lc0a1:

Click to download the PDB-style file with coordinates for d4lc0a1.
(The format of our PDB-style files is described here.)

Timeline for d4lc0a1: