Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (16 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [256284] (6 PDB entries) |
Domain d4lbza2: 4lbz A:213-312 [253543] Other proteins in same PDB: d4lbza1, d4lbza3 automated match to d1b23p1 complexed with gnp, mg, nh4, so4 |
PDB Entry: 4lbz (more details), 2.22 Å
SCOPe Domain Sequences for d4lbza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lbza2 b.43.3.0 (A:213-312) automated matches {Thermus thermophilus [TaxId: 274]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp
Timeline for d4lbza2: