Lineage for d4lbza2 (4lbz A:213-312)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544344Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1544345Protein automated matches [226946] (16 species)
    not a true protein
  7. 1544411Species Thermus thermophilus [TaxId:274] [256284] (6 PDB entries)
  8. 1544416Domain d4lbza2: 4lbz A:213-312 [253543]
    Other proteins in same PDB: d4lbza1, d4lbza3
    automated match to d1b23p1
    complexed with gnp, mg, nh4, so4

Details for d4lbza2

PDB Entry: 4lbz (more details), 2.22 Å

PDB Description: Identifying ligand binding hot spots in proteins using brominated fragments
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d4lbza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbza2 b.43.3.0 (A:213-312) automated matches {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d4lbza2:

Click to download the PDB-style file with coordinates for d4lbza2.
(The format of our PDB-style files is described here.)

Timeline for d4lbza2: