Lineage for d4lbza1 (4lbz A:3-212)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868774Species Thermus thermophilus [TaxId:274] [256283] (6 PDB entries)
  8. 2868776Domain d4lbza1: 4lbz A:3-212 [253542]
    Other proteins in same PDB: d4lbza2, d4lbza3
    automated match to d1b23p3
    complexed with gnp, mg, nh4, so4

Details for d4lbza1

PDB Entry: 4lbz (more details), 2.22 Å

PDB Description: Identifying ligand binding hot spots in proteins using brominated fragments
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d4lbza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbza1 c.37.1.8 (A:3-212) automated matches {Thermus thermophilus [TaxId: 274]}
gefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargit
intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
hrnpktrrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d4lbza1:

Click to download the PDB-style file with coordinates for d4lbza1.
(The format of our PDB-style files is described here.)

Timeline for d4lbza1: