![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (37 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [256283] (6 PDB entries) |
![]() | Domain d4lbza1: 4lbz A:3-212 [253542] Other proteins in same PDB: d4lbza2, d4lbza3 automated match to d1b23p3 complexed with gnp, mg, nh4, so4 |
PDB Entry: 4lbz (more details), 2.22 Å
SCOPe Domain Sequences for d4lbza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lbza1 c.37.1.8 (A:3-212) automated matches {Thermus thermophilus [TaxId: 274]} gefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargit intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm hrnpktrrgenewvdkiwelldaideyipt
Timeline for d4lbza1: