Lineage for d1hnzq_ (1hnz Q:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14165Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins)
  6. 14207Protein Ribosomal protein S17 [50304] (2 species)
  7. 14210Species Thermus thermophilus [TaxId:274] [50305] (6 PDB entries)
  8. 14213Domain d1hnzq_: 1hnz Q: [25354]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzq_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1hnzq_:

Click to download the PDB-style file with coordinates for d1hnzq_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzq_: