Lineage for d4l60a2 (4l60 A:127-256)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977199Protein automated matches [227006] (3 species)
    not a true protein
  7. 2977214Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233826] (5 PDB entries)
  8. 2977224Domain d4l60a2: 4l60 A:127-256 [253530]
    automated match to d1plqa2
    mutant

Details for d4l60a2

PDB Entry: 4l60 (more details), 3 Å

PDB Description: Structure of C81R Mutant PCNA Protein Defective in Mismatch Repair
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4l60a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l60a2 d.131.1.2 (A:127-256) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfnd

SCOPe Domain Coordinates for d4l60a2:

Click to download the PDB-style file with coordinates for d4l60a2.
(The format of our PDB-style files is described here.)

Timeline for d4l60a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l60a1